NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334979_0014604

Scaffold Ga0334979_0014604


Overview

Basic Information
Taxon OID3300033996 Open in IMG/M
Scaffold IDGa0334979_0014604 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5347
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035281Metagenome / Metatranscriptome172Y
F036210Metagenome / Metatranscriptome170Y
F061803Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0334979_0014604_1936_2151F035281AGGAGMMKFAFVFALMVLGSSAYAGECSTGSCTLRSRVVNVTREVIAVPVTVTRRTVEATRNVGRKTVARVRSVVR
Ga0334979_0014604_2952_3215F036210GAGGMKVRYISEVNRKEIQRKYIDQILGELDFMQIKDRLRDYLSKDKDKSSNYSLESEIRKEAPEVLVENWEDFDQPATLAKKRKEGFHHA
Ga0334979_0014604_4142_4285F061803GGAGMQIDINKQEAWKLMDAVQAYLKDYTLTAQANKTFDTITKKLKEVVKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.