NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334982_0002483

Scaffold Ga0334982_0002483


Overview

Basic Information
Taxon OID3300033981 Open in IMG/M
Scaffold IDGa0334982_0002483 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11400
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (70.59%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000635Metagenome / Metatranscriptome970Y
F012569Metagenome / Metatranscriptome279N
F020886Metagenome / Metatranscriptome221N

Sequences

Protein IDFamilyRBSSequence
Ga0334982_0002483_3776_4474F000635N/AMTLTEIAQYAGEKVGKTDSDTLTFLQKAASLAYRRVWDFAPWRETVTNSTYSVGTSRTITLGTNVETPLSVAYNDAEVDPIDLATIVSQDPGLLSDDRTGDPDTYHFTGRNSSGVAQLNLYPRLATSGTIPLRVVEKLKCITRSNYIVDFPPSTDALGDELRLPHVHHLVLALTHADALERERQYTKAQVITQGANSDLAAMANYELSQVGGVKQITPQSLGELTIEEMFSA
Ga0334982_0002483_6205_6453F020886GGAGGVSLDEVADLRDKVQNVSIALVRMEERQMTLYSMIEKSLAFHGDVANRLGALEHLRTKVLAVAGLIGLACSMAWDVLKNRLSN
Ga0334982_0002483_8572_8811F012569N/AMSRALDKFQGQYGFSVGTTGTAPAGYWAIQMLADTTFSTISGKFDGTLTGVTIGAGNIIYGEFNSYTAGTGTVIGYIAG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.