NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334977_0010352

Scaffold Ga0334977_0010352


Overview

Basic Information
Taxon OID3300033978 Open in IMG/M
Scaffold IDGa0334977_0010352 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5320
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (68.42%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000919Metagenome / Metatranscriptome834Y
F001881Metagenome / Metatranscriptome622Y
F017818Metagenome / Metatranscriptome238Y
F063620Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Ga0334977_0010352_2246_2503F000919GGAMRFRNIEFRFSKYNNKYELVRWYEDIPGKEICYVIAFFDKDKEGYDMRTIGDRFFEDKDAWVVGKYGLEFLNAIFQIEKDEEELK
Ga0334977_0010352_3004_3243F017818GAGGMNKDAYYDWIAENDTYPEHSHKWIVGLYNKYEGVEGLHRYFGTFDTREEAKVFAADYREKYTKPGFISSVRVFPLCEVL
Ga0334977_0010352_5146_5319F063620N/AMTNPIIPKVAYIPLEYHMSVEDFLEVWKDMEMEEEPTQEDYDTFILDRGKSYFYDMRG
Ga0334977_0010352_752_958F001881N/AMNVKMTERAQEFMNKIWEARNSDADTEEKLVAAILNLAAENIQFFQAQDGRIVLDKNDMLQLAEELTQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.