NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334844_014384

Scaffold Ga0334844_014384


Overview

Basic Information
Taxon OID3300033743 Open in IMG/M
Scaffold IDGa0334844_014384 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1582
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3533Long. (o)19.0467Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071066Metagenome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0334844_014384_1100_1402F071066N/AMATNDLLPTALVATGTAPAAIPQLAPTPVGPQKDRFAKQAGPDVSFKGPDGLTEAYAVFQIDPESKQIQVTVVDAQGQILRVIPARSVTQMMESMGRYRP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.