Basic Information | |
---|---|
Taxon OID | 3300033742 Open in IMG/M |
Scaffold ID | Ga0314858_141476 Open in IMG/M |
Source Dataset Name | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 617 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Alaska | |||||||
Coordinates | Lat. (o) | 71.2943 | Long. (o) | -156.7153 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048241 | Metagenome | 148 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0314858_141476_2_220 | F048241 | GGCGG | MTVSESRDRLKDRYIKWYTKDAITPIDIEQMVHDAKYSWWEREKDCQEWCDKEESYVPMSDSKTLKIMRQWFK |
⦗Top⦘ |