NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247830_11405055

Scaffold Ga0247830_11405055


Overview

Basic Information
Taxon OID3300033551 Open in IMG/M
Scaffold IDGa0247830_11405055 Open in IMG/M
Source Dataset NameSoil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)558
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From Agricultural Site In Penn Yan, New York, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.673Long. (o)-77.032Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002553Metagenome / Metatranscriptome549Y

Sequences

Protein IDFamilyRBSSequence
Ga0247830_114050551F002553N/AMRDAEVAYAIHPIVRKYLLNVKDTTKALIACGVPRAAN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.