NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316628_100165424

Scaffold Ga0316628_100165424


Overview

Basic Information
Taxon OID3300033513 Open in IMG/M
Scaffold IDGa0316628_100165424 Open in IMG/M
Source Dataset NameWetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2611
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3769Long. (o)-82.5097Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084411Metagenome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0316628_1001654243F084411AGGVRRRVLAAAVALLAAGCGGGGSSSPTTPAAPTPSGDATKLIVLDSNTFDALVLGVARPSLVKFQSPT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.