NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316621_10026198

Scaffold Ga0316621_10026198


Overview

Basic Information
Taxon OID3300033488 Open in IMG/M
Scaffold IDGa0316621_10026198 Open in IMG/M
Source Dataset NameWetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2617
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3778Long. (o)-82.5111Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007521Metagenome / Metatranscriptome349Y
F018704Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0316621_100261983F018704GGAGMSYSNLSAVTKTASDDAIAGRTRVAAIYYTCTSTASSFSLKNGSTSGGTALVTINTPAAAGAVDLIFPDMGVLFDQGVYIDITDAEVESVTLFFYGGAAA
Ga0316621_100261988F007521AGGAMAGRGMGCATRGGGAVESGPRNKMLSETSKKTGPVMMKNGGAINAHKKMAMGMMGGGMAVKGYKKGGMC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.