NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334722_10860740

Scaffold Ga0334722_10860740


Overview

Basic Information
Taxon OID3300033233 Open in IMG/M
Scaffold IDGa0334722_10860740 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)640
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5107Long. (o)-110.3566Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003877Metagenome / Metatranscriptome464Y

Sequences

Protein IDFamilyRBSSequence
Ga0334722_108607401F003877N/APVQTASRNFIGDEGRSFGFGDQVADPKPPRAALVKSHGGERRGNVGTMIPAGTVERGERKRTVDEVSKAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.