NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335073_10000014

Scaffold Ga0335073_10000014


Overview

Basic Information
Taxon OID3300033134 Open in IMG/M
Scaffold IDGa0335073_10000014 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)276383
Total Scaffold Genes253 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)190 (75.10%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001517Metagenome / Metatranscriptome679Y
F012173Metagenome / Metatranscriptome283Y
F020432Metagenome / Metatranscriptome224Y
F088562Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0335073_10000014130F012173AGGAVLLIDTSHAKRDLRADVLRKRGMDVDSAADIVEARTWWRPALYDLVLINMEKGFGQRDKFCDDLRNATPPQRLAFLVGQPEYLTTLPTADQELLMQSQDEPRAMETAKVIFPAGPEDLTQRWGILEASRRISAVRSAYVARSRAIRALPPPPRDSEDRASRPSTLDDLLRKEMQ
Ga0335073_10000014137F020432AGGAGGMMVPAKGPNRLNMKFTKSGTKLVIHLVRGLPPKLSRDKKTITITFLDDSRSKGAQS
Ga0335073_1000001420F001517GAGGMCGKQEKVMVKKEPSLISSSDQSLVLASLEHDQLARAKKHFIPRRHLKGPELLVLWALRLYLLFMMAVVGYQVWAAVR
Ga0335073_10000014236F088562AGGAGVTEKQPLNLVVAYDRNRNEYSVAAHNLTQQEAEAHVTQQTPHLRSDCSFIVLPQKKQHRSEPKDCRACRETVSRSAHLSPSPTFVRRQEP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.