| Basic Information | |
|---|---|
| Taxon OID | 3300032955 Open in IMG/M |
| Scaffold ID | Ga0335076_10014457 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7934 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (72.73%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Florida | |||||||
| Coordinates | Lat. (o) | 26.5059 | Long. (o) | -80.2517 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006153 | Metagenome / Metatranscriptome | 380 | Y |
| F090979 | Metagenome / Metatranscriptome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0335076_100144572 | F090979 | GGAG | MLRGIIPGLIVALAIGGPTSKAYAQDPTARCVSVENEQMTIASAQSRGLDIENFTEAETTAFLEAFNAAPPMSNFVATKMFAAVGHDRAYVFFESGHDLCTPPSPLPRAIYGELAERARGEGA |
| Ga0335076_100144573 | F006153 | GAG | MKRLRSWTGVVFAALYALTFLALYVWYLVRAGTWFADLPLALAALPFTLVMRALNGGSYAFGGDMTGRVIAAGVFCAALAYAAGLIVETIVRLLMRRLLPARWSAD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |