NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335079_10010410

Scaffold Ga0335079_10010410


Overview

Basic Information
Taxon OID3300032783 Open in IMG/M
Scaffold IDGa0335079_10010410 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10583
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (81.25%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000586Metagenome / Metatranscriptome1007Y
F025398Metagenome / Metatranscriptome202Y
F044645Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0335079_100104101F044645N/ANTVLAGVRKQEITLELDAIKQALNLEKAVEGADLTLNRFKLQVI
Ga0335079_1001041016F025398GGAGMSAFPAVLPNPRTSAPAQYLRSESFSHEGTARSRAPWLIAPGPSLAVPRLDRVGLRHSSFGSDAAAARFATILIDLGIGNPSDWSLCGREPASFLRHTLNRFVQRPTEAAIDGAFDL
Ga0335079_100104104F000586N/AMNHADPGTMRARARQAIEILKAQLLQTGTVEPLVALYFADHIEQVQFEDPSVLDHFNLRTARSFDYLRILVGIRKPQAAMMTLDVRMGPFENDERDDVVAEKTAIFLMLDSPLLTIQVILPYRRSGGRVAVSEVHYTEMPGDENASPCPIFKIFSEAPMAVC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.