| Basic Information | |
|---|---|
| Taxon OID | 3300032401 Open in IMG/M |
| Scaffold ID | Ga0315275_10290859 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1828 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.5111 | Long. (o) | -110.3555 | Alt. (m) | Depth (m) | 100 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050262 | Metagenome / Metatranscriptome | 145 | N |
| F055381 | Metagenome | 138 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315275_102908591 | F050262 | AGAAG | MKITCHRRQRTSGATLVEMVAAIIILGLVVTGVAQFLLVSKINVYTDNVKTGVLQALSDTIVKYQTMSVGETNVPVGDDLRPHIPSGTMRLEKSGPANGVYTLQGSVTWRAFPHGDDSFLFH |
| Ga0315275_102908593 | F055381 | N/A | MKLLLKLLFVLPALAATGSSIREVYLPPWYDNASFQTFELEIKDLPVHCVQLDHPCTLFCTNQVVMVSNGMARARLLIDLKKTPATFPIIVMAPDANGRMTPRQKLICHLSLVPLPIQVEVRGDTFTVTNLTQEPFELERAEAVNITSQDDRHIAGTLNGSGRLKLKGRAEIRLNPKPGSGGPG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |