NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315275_10164250

Scaffold Ga0315275_10164250


Overview

Basic Information
Taxon OID3300032401 Open in IMG/M
Scaffold IDGa0315275_10164250 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2467
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5111Long. (o)-110.3555Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007302Metagenome / Metatranscriptome353Y
F074258Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0315275_101642501F007302GGAGGMKVQKTGTIVGIVQSEDPVKIRVQVKLDEETLEQRVRPYPQSEQERMSQQMTESIAKQLRTAIPGALVMGPGFAGVSGSNLEEWLVPADQGSKLSIGKRVRVSLEL
Ga0315275_101642503F074258GAGLPLFLVALALIALMTVPAFADPVAATSPSIGDRYAITPISGEARAWVAGSWVVSSANLQLVVQVTNVGPNNIIFRTLSGTIRFDDKVYNIVAHGWRGDYNRVSKTCVYQGPAIAPNGARAFFIIYGHDTSDTQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.