| Basic Information | |
|---|---|
| Taxon OID | 3300032278 Open in IMG/M |
| Scaffold ID | Ga0310345_10017570 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5985 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (54.55%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → environmental samples → uncultured marine thaumarchaeote KM3_54_G11 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: North Pacific Subtropical Gyre | |||||||
| Coordinates | Lat. (o) | 22.7719 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001034 | Metagenome / Metatranscriptome | 798 | Y |
| F008820 | Metagenome / Metatranscriptome | 327 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310345_100175707 | F001034 | AGGAG | VLASQQAYEDAQYQSTTPIGPQPPCPDGVHDIELSWDRKKGYMRIIIGGEKWWFKEYLGKAQVLGTDNQRGRLYLRAIAQINGETLTMWRDPNAPPHENVSGKIRKKTHNRLCYRRATEEWRLRDERMDWNDPEALVFTKSYVGDLNAEWHANDSIAHIYHNGYAIIDDDDIAHLYDPDIMYG |
| Ga0310345_100175708 | F008820 | AGGAGG | MANLTPYLTEKYTKMIAEITADLGKTADDLANAQNIIKALKNPDMMVNGASLTLDMVQIMENGDIRLLPPVPTPITETCVKAPEPDKNGKRPEKELVSVS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |