NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316208_1009597

Scaffold Ga0316208_1009597


Overview

Basic Information
Taxon OID3300032254 Open in IMG/M
Scaffold IDGa0316208_1009597 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5005
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Maine
CoordinatesLat. (o)43.8603Long. (o)-69.5781Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010198Metagenome / Metatranscriptome307Y
F016899Metagenome / Metatranscriptome244N
F017221Metagenome / Metatranscriptome242Y
F019812Metagenome / Metatranscriptome227Y

Sequences

Protein IDFamilyRBSSequence
Ga0316208_100959710F010198GGAGGMKIANKDGFRYGENAYLIGNEFGLLCVAYGNNEQEALDNAVDADCMDSELMSDSDHAEYDANGWHDSFIYAGNASEPFWSEYLWIKPANERERAA
Ga0316208_100959711F017221GGAGMDYIKNDYELQQLALSIALEAIEEVKQHGGDHYELIDQAAASSEHAIYTYKAIMLCANCCTADAEAMLDDNGCERFDSFAHHASVLAEVTIQNAALQEFYELGGEVAA
Ga0316208_100959712F019812AGGAMDNQRQIEINRAHAYLIQKEMEKELKRLDRVYYFVITLAVTTTLASIITYINLNWSV
Ga0316208_10095974F016899GGAMFKEYMMSGTMNPEVQAVFKAAADISNGVFSLQEAAKFYKVPSPIIVQFIAESSEYDMVFSKVGDYDSNN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.