Basic Information | |
---|---|
Taxon OID | 3300032251 Open in IMG/M |
Scaffold ID | Ga0316198_10005344 Open in IMG/M |
Source Dataset Name | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7922 |
Total Scaffold Genes | 11 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (72.73%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Netherlands | |||||||
Coordinates | Lat. (o) | 51.4666 | Long. (o) | 4.071 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F039645 | Metagenome | 163 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316198_100053444 | F039645 | GAGG | MPTPITAFADAAAKYGDIDPNDIEAVQNWFADELPKLPVDTIEQVLHDLLERDGTAAEREIVPVYPKRAPLPSLGSSPPALPPLLAERWRTLLGRLVKRRRRR |
⦗Top⦘ |