Basic Information | |
---|---|
Taxon OID | 3300032157 Open in IMG/M |
Scaffold ID | Ga0315912_11667055 Open in IMG/M |
Source Dataset Name | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 501 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.0136 | Long. (o) | -118.4673 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024643 | Metagenome | 205 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0315912_116670551 | F024643 | GGA | MLSPGMFRDAIRRMSLRKKLTILISLGVVLPVLVLTFLQYRSLTELENKNKGAFKDSLRQRLTNVQLQMKQRLEEVASQTLKPIDNLRLSSADGSNEFGKYAADVKRSHPEIQEIFVVGYRDDQQNTPAQSQILSLFDR |
⦗Top⦘ |