NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315905_10003345

Scaffold Ga0315905_10003345


Overview

Basic Information
Taxon OID3300032092 Open in IMG/M
Scaffold IDGa0315905_10003345 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16575
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (93.55%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.8268Long. (o)-83.1913Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001515Metagenome / Metatranscriptome679Y
F018684Metagenome / Metatranscriptome233Y
F026858Metagenome / Metatranscriptome196Y

Sequences

Protein IDFamilyRBSSequence
Ga0315905_1000334514F001515AGGAGMTNKSSFDLDFGYGRKGEQLVDELLTGGRTVEVKRDRKWAKTNNLYIETECYFKKIEDWAPSGLGVTEAAYWAFVLEESTLIVPTDALRWCVKEFGREITCNIPPNISKGFLITVDDLMSATRLYKKAMADELATN
Ga0315905_100033452F026858AGGMMHDNLLLDLTPREVEVIRMALRQTQDTHQRNGFKVLVTEVEELRSKIANAIIDNHTNGKPVSV
Ga0315905_1000334522F018684GGAMEDWKLQVSYKTPAGDMINIRANTADELSVLLEGIGDYSTQVAAVQRLVVGAYNAAPLGTTPSTQGTPPSTYSAPTQAQGPLLTPPPSAVTPSGTASPTCVHGARVFRQGVSKNTGKPYAFWACPTPQGTPDQCKPVN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.