| Basic Information | |
|---|---|
| Taxon OID | 3300032092 Open in IMG/M |
| Scaffold ID | Ga0315905_10000230 Open in IMG/M |
| Source Dataset Name | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 60901 |
| Total Scaffold Genes | 50 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (42.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae → unclassified Mimiviridae → Terrestrivirus sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Lake Erie, Ohio | |||||||
| Coordinates | Lat. (o) | 41.8268 | Long. (o) | -83.1913 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015835 | Metagenome / Metatranscriptome | 251 | Y |
| F016120 | Metagenome / Metatranscriptome | 249 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315905_1000023027 | F016120 | N/A | MSHPKKNLPSTHRQTMEEATAEAEARQLEYDPAVRAQYIRSMIRDIPKWMAEGESEESIKQRVPDFVESYPELFKKLIQQRDMTPIHNMLTMLDKMAEGRLSQHQASVIVGKKLVDRYVTPQLHGKERK |
| Ga0315905_1000023037 | F015835 | AGGA | MSDPGIGTYVRYWLHYTNLASTFFKQFGSVRKIRDDYEKQVINLLQTNGMEKATIQINQGQIRVIDKRDPNPLTLSKLEELLHAYYRQRGGKDETLDIMTFIRANRGYTISKSLRQTGMPTPKQPQLANGLIGGTPPNL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |