NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315316_10718328

Scaffold Ga0315316_10718328


Overview

Basic Information
Taxon OID3300032011 Open in IMG/M
Scaffold IDGa0315316_10718328 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)829
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002915Metagenome / Metatranscriptome521Y
F073140Metagenome / Metatranscriptome120N
F098743Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0315316_107183281F073140N/AADMQWQLEGEDDPNKKRISILHTKPYGCHFMSNNKWLSMYYYLVYRDEGMGCLWESSNPNVRIKYSVTLKTFVIAPEQGKCILGD
Ga0315316_107183282F002915AGGMKRLLLLSLIIPIIAQGKEVFTNEQGLKIEYVKPSVSCFYDKEAYEGYLNTCLMLPNYETCAQTKYENYICSDQNMIKKLEKKANETEKQN
Ga0315316_107183283F098743AGGMKYLILLCFIIAITTCAMAHDTSSEFYIPSESNAYQGRLIYDSSKEVYPIDK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.