NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307416_100140672

Scaffold Ga0307416_100140672


Overview

Basic Information
Taxon OID3300032002 Open in IMG/M
Scaffold IDGa0307416_100140672 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2193
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025543Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0307416_1001406721F025543N/ASLDLSHEIKRMGDGMSYGLALRVAATHAEWLPTGNAAITRGTAYRASFGPSIMIKGLTASSQLGIYTDGKETLQEVSTFVSLNGGLTEVRTPVTVTLEKTFAFGGEPLIPRRRDQLERLTLGFDVVRNFALRLGMTTHRSAWPTQDRRSDLKASEVYYMIGGQYTISW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.