| Basic Information | |
|---|---|
| Taxon OID | 3300031997 Open in IMG/M |
| Scaffold ID | Ga0315278_10036891 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4742 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.5094 | Long. (o) | -110.5094 | Alt. (m) | Depth (m) | 88 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010820 | Metagenome | 298 | Y |
| F018243 | Metagenome | 236 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315278_100368912 | F010820 | N/A | MKPYLAALLWIAVSLASPVEAGDPVVVVQETRTPVVSKKHGSKKPGTVEHVVLLKNVSPYPVRGLRVTVGFYDFFGKLLLVRTGTPVPASLGPGDTATLSLSTPTLEAARQTRYRFQYGGGPPQHARPRPKRGGRDPAGRGRPIPLRPAPA |
| Ga0315278_100368914 | F018243 | GGAGG | MDGPRLLLMMAALFLGAGCAASLTPEQKLSHEIFVEAAHECESRYHTIHVDQIDLEGGLKLHADADSRSEYRAFVACYHDALKARTEARRKAGLPVPETLMHEPDVELD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |