NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308175_100423785

Scaffold Ga0308175_100423785


Overview

Basic Information
Taxon OID3300031938 Open in IMG/M
Scaffold IDGa0308175_100423785 Open in IMG/M
Source Dataset NameSoil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1397
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.8864Long. (o)-122.2981Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003246Metagenome / Metatranscriptome498Y
F012928Metagenome / Metatranscriptome276Y

Sequences

Protein IDFamilyRBSSequence
Ga0308175_1004237852F012928GGAGMMLILKIPIVYLGLVVWYAIRAEPEPGVDPTEYSTWRPWRSPTTPRPRRGGPHGSRDSARTEHARRDRVAP
Ga0308175_1004237853F003246GAGVTSTTRDNWQPHEAVAGLMAAGALFLGAFELVYRPFRLAPVAVILLLFATVMTQRQQRLVGIGFAVVGICFVVGAALQVWTKHPLF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.