NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307406_10120993

Scaffold Ga0307406_10120993


Overview

Basic Information
Taxon OID3300031901 Open in IMG/M
Scaffold IDGa0307406_10120993 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1820
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024881Metagenome / Metatranscriptome204Y
F054633Metagenome139N

Sequences

Protein IDFamilyRBSSequence
Ga0307406_101209931F024881GGAVNRAFPSALAALLALVLVSFAASGCGGEGSASAEPSHSTSTTASEPTCPPGLERGWQKLASQIDAAVYCPSWLPDPLVGRIGGQWEGVHSVTKENSYLVGFIWFERGAGEVHVNLRGYPGQTKVPTCNGKPCFSGERGTREVAGRTVDVYTVNRGADTWHVLYAWKDDGSLYSVSQHVVPELGLSYSQVVKYLDLIMAGLVKIEPQQS
Ga0307406_101209932F054633N/AVKPKIAALAATTTLACGLLATACGSTDHEAHAQSLYNAYRTAEDSRTDAEEELRLAFRDIANAAQAQDRDAVLEAAERGQDAVEEINDLITAELEAAQGLSEIDSVSAHAKQLSDGLRLSRSSLALIAEELTIALDDPFLETREKEIDDLAKESADLAVKGELAIRRADHALALALGLKPRPDQMFTTTSG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.