NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307406_10086746

Scaffold Ga0307406_10086746


Overview

Basic Information
Taxon OID3300031901 Open in IMG/M
Scaffold IDGa0307406_10086746 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2097
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019222Metagenome / Metatranscriptome231Y
F028304Metagenome / Metatranscriptome192Y
F037922Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0307406_100867461F037922N/APDTRTPSGRLPEVLAAPLSGHLMIRAQVRASTSDEKEILPMQNLPKIETVEQAREVLIEMDEEQEITAELDEWKASITKDNDQEFSVSFADYETGIINLWNASHILVELGDHDLYLS
Ga0307406_100867462F019222AGGAGMSEEELEERGIFVKEYGERTLKAARLYSLLRQECGIEEPWHIMALTTCAFEQMHIKDGWEFVLANKQDIEDVGQLFERSSTPEEFRDGLIELKERDLMEQLERDGPDL
Ga0307406_100867463F028304AGGAGGMARPGESKEDIKRALAGLGWEIRTDDEGSGAVMGAHGKYHLMVSFEGEKPTSVLISYIGKGGEILSRNWSGIERLPTPQSVVRAFSRE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.