NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315285_10153591

Scaffold Ga0315285_10153591


Overview

Basic Information
Taxon OID3300031885 Open in IMG/M
Scaffold IDGa0315285_10153591 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1907
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.508Long. (o)-110.3268Alt. (m)Depth (m)93
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015720Metagenome / Metatranscriptome252Y
F028111Metagenome / Metatranscriptome192N

Sequences

Protein IDFamilyRBSSequence
Ga0315285_101535911F028111N/AKTLQEERDTLSERVRLLDIERHPNFVKKYESKITGVFDSMKTVVGTEGDRLIGLLKSPENEYRNSQIDDIVDNLSASKKAKLGALIVRYDEINGERSSEMSEAKSDYDTVVSRYKEENDSNTAFALESATKTWTKVSEDARALEIFEPRENDEEWNVELNGRLNLARQIFNGENSEEDLAKAALWAAAAPKYRELLYSQVEVNKRLTAELAKYRGNQPGVASRSGISNNNPKSDASKSESFVANVMKSLGR
Ga0315285_101535913F015720N/AMSNYKTTLAGVGAILVAIGCALKALFDGDSNTNLDPSQLLIGITAGFGLIMAKDAAKSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.