| Basic Information | |
|---|---|
| Taxon OID | 3300031852 Open in IMG/M |
| Scaffold ID | Ga0307410_10071281 Open in IMG/M |
| Source Dataset Name | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2409 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 38.5 | Long. (o) | -121.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011886 | Metagenome / Metatranscriptome | 286 | Y |
| F019681 | Metagenome / Metatranscriptome | 228 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307410_100712814 | F019681 | AGAAGG | MADAGATPEGRPWAVAGLVLAGLGLAMFPIGGLVGVVCGGIARSKGDGSLGLAAVVASVISFFASFVVAALVLN |
| Ga0307410_100712815 | F011886 | N/A | VPLALAAGPLYGSGMELEVGPFDPALHIRSRDHYEAVRREAQLLSLGPEAAPARFEELVDRLGRQFPPSPVDEVADRAYLAREPSFAVRRDLPDELVPAALAACDELEELLDEFDRWANAEGVQLLEAPEDIKQYRKAYLDQVRAQLQKANG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |