NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255338_1000466

Scaffold Ga0255338_1000466


Overview

Basic Information
Taxon OID3300031825 Open in IMG/M
Scaffold IDGa0255338_1000466 Open in IMG/M
Source Dataset NameSandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)131581
Total Scaffold Genes118 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)78 (66.10%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameCanada: Vancouver, British Columbia
CoordinatesLat. (o)49.2598372Long. (o)-123.2459363Alt. (m)Depth (m).35
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013019Metagenome / Metatranscriptome275Y
F015396Metagenome255Y
F018447Metagenome / Metatranscriptome235Y
F025138Metagenome / Metatranscriptome203Y

Sequences

Protein IDFamilyRBSSequence
Ga0255338_100046610F025138GGAGMARKPVGLAVLGTLLMVVCDDGAVYELDPNGSWIERRPVPGTAAAHSDEIRRQEPRFD
Ga0255338_100046650F018447GGAGVIYEAHLRATEENAWPLDTSIAWDAIDLDVAREEHELHRALHDAALIEGYLPVYAARLMQLLWDDVDATAVLSMELYEGLKHFTALTRYLHRVGYQGEDASAAALVAARERALGIRYDARELTAHLTNFMCSELFAAYFFLRIARRTREPVLRALLGYMSRDEFRHSASAGDVLKQRIDRDPAAAAAVLAAAEHFRHYGSDVVDVPVAEENDFEAIMAVNRKVRLLCGLAPTEHLKESISGGD
Ga0255338_100046663F015396AGGAGMATLSKQYEVVYHQAGEHVPEPTLAALATRLVRTTVPRRLYRLFHLALPVAIDLGMRGWWRGAGWSLALAAFGAWGLADHWMAESAADNPSRARLVRVVRVIAGALAVVPPVVLLLEAFLRLLGKAPIS
Ga0255338_100046671F013019N/AMARSFLESALAGTLPSFAGAWEAQRRAYPPGTPPSDADFLATVRTHVVHLLGDGRVAETTRFFYALERLLGEADPILEELLERDLVGALAVECRLAAIDVRRIDPYLGRRTRAAWERARA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.