| Basic Information | |
|---|---|
| Taxon OID | 3300031813 Open in IMG/M |
| Scaffold ID | Ga0316217_10099191 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1348 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 46.0411 | Long. (o) | -89.6861 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000926 | Metagenome / Metatranscriptome | 832 | Y |
| F001490 | Metagenome / Metatranscriptome | 685 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316217_100991911 | F000926 | AGGA | MSQFLAGQPSGIAVQELEVLVRTVVFKSANTLVGWLLQQAADRIDAAYHPKAGQQYKGRVSLQIDGMFGKSPLERDYYYHPGKKEGHYPADAALGLEGGHTPALARLMCLEGADQSSYQKAELHL |
| Ga0316217_100991912 | F001490 | N/A | MKESNPSQILQQIAQIRRMEPGKVCVMGQGPNGPYYNLQCRENGKSTSRYVPADQVEVVTQHTENYQQFQDLVSQYAQVIVAQTRAERAAGVKKKTRPSKSSWPKTRKSKR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |