NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316217_10000464

Scaffold Ga0316217_10000464


Overview

Basic Information
Taxon OID3300031813 Open in IMG/M
Scaffold IDGa0316217_10000464 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)58015
Total Scaffold Genes52 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)49 (94.23%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.0411Long. (o)-89.6861Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061453Metagenome / Metatranscriptome131Y
F091596Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0316217_1000046415F091596GGAGGMAHDPGSVAPQTGIYWCSVCKLPVQFKAGDTLPVCKNLCGRGKWEFVRAEK
Ga0316217_1000046435F061453GGAMAIAAKQNSRTATFLSQMAKPVAATAGPVILFTAGGVRFAVEANEVSEIRDGEERGAACRLKGSAPVDFALQVGLGAGRMVRFLVLKPGEGASGATPGVTPDATQGATLSVTLGVTEVERMTSLPRVVPLPGLFQGAERQWYRGLLLLENEVIPLVRTRYWRQAGAPLERAGERA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.