NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310125_10376128

Scaffold Ga0310125_10376128


Overview

Basic Information
Taxon OID3300031811 Open in IMG/M
Scaffold IDGa0310125_10376128 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)693
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)79.9957Long. (o)-149.9767Alt. (m)Depth (m)432
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025846Metagenome / Metatranscriptome200Y
F067833Metagenome / Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0310125_103761282F025846N/AMNALKAVLMVNLTVAMDLVSMAHGHVTEWVTALMAVMKPIVLLHHVKTKVYGIVAMANVFQHHMYVMAQVNSVTQAGVLTVPMAQMKA
Ga0310125_103761283F067833N/AIVLLHHVKTKVYGIVAMANVFQHHMYVMAQVNSVTQDGVLTVPMVQMKA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.