NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315899_10004749

Scaffold Ga0315899_10004749


Overview

Basic Information
Taxon OID3300031784 Open in IMG/M
Scaffold IDGa0315899_10004749 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14668
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)23 (92.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.8268Long. (o)-83.1913Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000368Metagenome / Metatranscriptome1223Y
F001706Metagenome / Metatranscriptome648Y
F018680Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0315899_100047491F018680N/AKLRKAKRADEKRIKELTEQLEGLSKVQRERTVKEVLEKKGVNAKAVRLILKDLDDVNEESVNNWLDDNADLFGLQVSDNGQNKEQTNIDLAALRQQDVITQNAMTPERAQDLNARLDNAQSAEELIAFLNSQN
Ga0315899_1000474924F000368AGGAGMNPQFKQAALSWFRAAAAAAVALYVSGITDPKQLGAAALAGLAGPLLKWLDPSATEFGRGSN
Ga0315899_100047494F001706AGGGGGMAYHWEEHPEPLDDCFGCKVMGLQVNAGDAKRDIPDKKWNAELQAYRDARDQGMRPAGTTMRDVQQAHEASEVLGTAYNSETMPKAEKINNKVAEVMKEIGQI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.