NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315331_10132696

Scaffold Ga0315331_10132696


Overview

Basic Information
Taxon OID3300031774 Open in IMG/M
Scaffold IDGa0315331_10132696 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1856
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007985Metagenome / Metatranscriptome341Y
F045787Metagenome / Metatranscriptome152N

Sequences

Protein IDFamilyRBSSequence
Ga0315331_101326961F007985GGAGMQQYKVNNTVFPNIEEATYYVSMLSKAAQATATITPYTPPSKASKKLSVVRNILIREMLEWAGSFVHSMTPSVDPCWMYSVEDANGFSDAGDTWYEDLEDVTYGNNLEWEDAKDDYEGAVSNFECLFGDYNSVTSVEGLSDMLNSMYHTMSDHSSETDNYIGCVRDSIKRMCEGNDNIAHSYHHPSRRTTISFSGNVDAMYKAYMLERNS
Ga0315331_101326962F045787GGAGMQKLLIKLLELMGITAGDKVVIEAVDYYLWRIDLPLGKIDGGTYEGKHWGDAVIEDTDAWLTFTVGNLYDSNRFSIGEGQVNLEYAEGNEGLAYTGDLEDVITARIKDLYNLNTDGSEQGMQGDDYISLDIWSEGVGDREVTDEQMDADYADEESENYLKQFCRFENYPGVNNRDLRQAVLAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.