| Basic Information | |
|---|---|
| Taxon OID | 3300031773 Open in IMG/M |
| Scaffold ID | Ga0315332_10004050 Open in IMG/M |
| Source Dataset Name | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8381 |
| Total Scaffold Genes | 29 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 18 (62.07%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 36.7468 | Long. (o) | -122.0193 | Alt. (m) | Depth (m) | 100 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007770 | Metagenome | 345 | Y |
| F039679 | Metagenome | 163 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315332_1000405019 | F039679 | N/A | MRAVNTETLEHDGSHLTIRNDLVADDLGVPVHFLDYKEDVHVFQTDTLNIDCIFSTDGEELYEGMGIIVRITDPTKEDKYGEPWKDRMAFAYSIDFDWN |
| Ga0315332_1000405023 | F007770 | AGAAG | MSGEGLSVSFRRTPETTKSNEQLLREFQKIIYASPVTKQMKRYGNDHSVEMMEHGDEELAKWQREAVAIKDTFKFTISVYESWHEDADLYESHDIEDSFVSLARKFAEDNAVLYFSEGYPAEWIEQEVIDGEKNWNHFVVYANDKNIDKICKVWHDYGLAQIKDDSKEIWYKARNKIKELMEHHDNYDYSI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |