NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315322_10093143

Scaffold Ga0315322_10093143


Overview

Basic Information
Taxon OID3300031766 Open in IMG/M
Scaffold IDGa0315322_10093143 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2180
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049233Metagenome / Metatranscriptome147N
F059362Metagenome / Metatranscriptome134Y
F090619Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0315322_100931431F049233N/AMKVTETDYQRKVLGDIGEKIVGNYMSRIGRTVEMSTDPFDSEKDMIVNGKPLEVKTQVPYCLEKSFTIRKNQLNKCLNVDYFVIVQAPCEYLNEAAIWKVKKGFTYNTVKLKGGDERLSIPMYQTNVIKKMDIVGEDKDLLRKYSTDYG
Ga0315322_100931434F059362GGAGMNRSMQLSGVIETGKPFLVEDNVKLRKTATIEGNIGKIIRVGTMNDTEFDYDIGSLIAIDDVSLVIRSLKSGDLKAYDLNCTNSGLYKGTIEV
Ga0315322_100931436F090619N/ARLVVLLVMDKCIMTSEKYIQIRTKVPINDDGTVFKEFNANEKFRRQDVSVMLRLLPLIAKYELEFLPKIVEYNEDGYTYEFVEGQTLKEEIDNGVLKLTQKMILEMKIAMDDIWKKFYEISIENKDDELFEGNGFLYHGDPWLGNVIWNDDTKEFKFIDIDSLSIADFVPLTQLNNMFFQHLETLLVTQWPNGQNKNQSTLGTWI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.