NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307476_10167436

Scaffold Ga0307476_10167436


Overview

Basic Information
Taxon OID3300031715 Open in IMG/M
Scaffold IDGa0307476_10167436 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1585
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043052Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0307476_101674362F043052GAGMTISYELAEYLSVKRTIRAPVGRVWPVFLDMNRWYTDYHWDWISGPPYEGVGLQEGQVLKASPLYGVGKQDPTLYYLQEQVKVTTETEIVVKITAANPKSMSSDYATEVRDIVAFYHWDFAGSGNSTTILIRSYSNLRTDKRPAETVLADLTTAFHRSWNKSLDMLETIVCDSSARGTS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.