NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307476_10001298

Scaffold Ga0307476_10001298


Overview

Basic Information
Taxon OID3300031715 Open in IMG/M
Scaffold IDGa0307476_10001298 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15311
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005311Metagenome / Metatranscriptome405Y
F005887Metagenome / Metatranscriptome387Y
F008092Metagenome / Metatranscriptome339Y

Sequences

Protein IDFamilyRBSSequence
Ga0307476_1000129811F005311GGAGGMSSGINGAALVRAASAMLTALGGDQVSLLLPATATASDAAGQLGLVDPGVQEIIVTPVVARNLPTGNLGPARRIEFTLPASAIDVQLPTLGLGKAEDLFDAALGLVYDGDLFHVEVVVTENFAGTAYFYVVTAVE
Ga0307476_100012986F008092AGGAGMSTTPSTTIVTNLKNLSSSTANTLRSGSSEGIDMAGMISLAVSKATELKICLSLIARVVDGGDPNLQTLNNILASLS
Ga0307476_100012987F005887GGAMGVSERDLVLKAIDIEFQREVLDKLVRLETKMDALVGNGQPGRVKLVEDKVAVLERNDLRNSMHNRLVNGAMSAAISAAIALHKYWLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.