NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310686_118675199

Scaffold Ga0310686_118675199


Overview

Basic Information
Taxon OID3300031708 Open in IMG/M
Scaffold IDGa0310686_118675199 Open in IMG/M
Source Dataset NameFICUS49499 Metagenome Czech Republic combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1433
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.043Long. (o)13.6183Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006039Metagenome / Metatranscriptome383Y
F033925Metagenome / Metatranscriptome176Y
F066005Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0310686_1186751991F066005GGAGMRDFLIADHGSIVSIMPISEAALKWIDENVVSEPWHWLGGALCVDRRYARDLTDEI
Ga0310686_1186751992F033925GAGGVADELNLDVDTPDKVARVLSAAASAYQASAVELSATWQDRHIPMIWAAIAGELDLAAWKIEKIVKQRLDPRQSPRRQK
Ga0310686_1186751994F006039AGGAGMPKFVIERQYLVPMYQHIVVEAETLEKACAMAVSDDIAWDSQEMDSDNARATTITEAKVIPDGYEVDPVQRLLIAGTDPNSLPLDMLGLASFVYEDEAKTGPLLEIPADFTDDE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.