Basic Information | |
---|---|
Taxon OID | 3300031659 Open in IMG/M |
Scaffold ID | Ga0307986_10160258 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1037 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Ocean | |||||||
Coordinates | Lat. (o) | -68.5958 | Long. (o) | 78.1913 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023715 | Metagenome / Metatranscriptome | 209 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307986_101602582 | F023715 | N/A | MVLLYFSYLIIVANIIILSVGYVANIAFIGSFLGGLMAIGTDPIILILGALLGAGLVAKPYKFSVIYLWLGAMFLTMLVH |
⦗Top⦘ |