Basic Information | |
---|---|
Taxon OID | 3300031654 Open in IMG/M |
Scaffold ID | Ga0315549_1002989 Open in IMG/M |
Source Dataset Name | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 15513 |
Total Scaffold Genes | 17 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (94.12%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Massachusetts | |||||||
Coordinates | Lat. (o) | 42.722 | Long. (o) | -70.847 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057772 | Metagenome / Metatranscriptome | 136 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0315549_100298911 | F057772 | GGA | LASGAEAGAAVLHQDPLDGVAASGAGFASLMSNLKIEMGCAQLALGADVGIHAGALLPVAARGTL |
⦗Top⦘ |