NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302114_10004092

Scaffold Ga0302114_10004092


Overview

Basic Information
Taxon OID3300031621 Open in IMG/M
Scaffold IDGa0302114_10004092 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - AG5_Surface
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8999
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (28.57%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)70.5467Long. (o)-122.9077Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012942Metagenome275Y

Sequences

Protein IDFamilyRBSSequence
Ga0302114_1000409214F012942N/AVLSEEGGEGGGGDVLGGEAEDIPDFFACISVLGKCKERCSLGPLDDFIGKGKWVSMDHSKSKKHEGVAVFLAISSNISKKTRIPVFEHFTHQLVIVLIDELVAV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.