NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308009_10089927

Scaffold Ga0308009_10089927


Overview

Basic Information
Taxon OID3300031612 Open in IMG/M
Scaffold IDGa0308009_10089927 Open in IMG/M
Source Dataset NameMarine microbial communities from water near the shore, Antarctic Ocean - #127
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1168
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5596Long. (o)77.8957Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053723Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0308009_100899271F053723N/AAATATALSTYSAGPTGLRTYAPGVNPPAHQRPVPAGAEQGKVVWAYTGAVTQGDAESIYNAKGEVTAEDLLNSPINHIAFIANVDVNQSTGWWAPGANNTGGCGQEQTFELPFGYRGYNKSAEAASLPTFQGNLRKLHSNGVTITLTLGSWCTELPISTKDEWTDAQFGEFVTYFEDVRQNVFGGYLDGIDFDWEGYCSAGCLKGTCECDWDDKICGEASPEELAAGIFWETSPAPGEPKLKKQCWIMPTSSTFQVMTGITNAMKKKNYVVTLVPMSTSLYSGEPEVMASPVLRNEYAKYAKHTFAGEQVDLLELSDGILLQWYSGFDATLCRNSGDPMACACNNVPDADYPNVLDSDKDVGGLLMASWQTYWNISGNMFPSTYPVRCQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.