NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307993_1000299

Scaffold Ga0307993_1000299


Overview

Basic Information
Taxon OID3300031602 Open in IMG/M
Scaffold IDGa0307993_1000299 Open in IMG/M
Source Dataset NameMarine microbial communities from Ellis Fjord, Antarctic Ocean - #260
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17006
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (8.51%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5958Long. (o)78.1913Alt. (m)Depth (m)18
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008425Metagenome / Metatranscriptome333Y
F017499Metagenome / Metatranscriptome240Y
F056622Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0307993_100029912F017499N/AMSRYNSRMHGVTTDKVYVDINWGFDHALGYWYDIIETKDGEETIIEEWSSTVSGGTRATMLEFLIKYNLSEEHRSLVALDMPL
Ga0307993_100029931F056622N/AMMTKDEEIVNMASCMLSILDYLKLQDNCTDGEDMLQTNDETLSEMMFRKMGGHNIDLNKELGFTHLKPVKKHN
Ga0307993_100029942F008425GAGVATGDITYKQFIAHMDKGNKVYMQKPKSWQKIWFWWESKREKWFLNKAYDKREDGEVIREKSVWLTAKQMDSHFNFMERQGYKYHIDE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.