NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307992_1025055

Scaffold Ga0307992_1025055


Overview

Basic Information
Taxon OID3300031601 Open in IMG/M
Scaffold IDGa0307992_1025055 Open in IMG/M
Source Dataset NameMarine microbial communities from Ellis Fjord, Antarctic Ocean - #133
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2726
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5958Long. (o)78.1913Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004606Metagenome / Metatranscriptome431Y
F008190Metagenome / Metatranscriptome337Y
F018962Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0307992_10250552F004606N/AMKTHRIFNKGQTVYCLLASHTNPNILLPVKGTILDSKWDPVNPLYQIRIIKLYDNMKFLKQHFFDMNFRHVFEHRAKRMTLKAEDFKTTRALEDRLNDKDRERFYVVIESVMCTKTKVGLSELFEKVQFYMISKNLKEIRDISTRPFFKGPLSLDSVKEFDTRYKISWSDKFKRGGLDIDKYLNSLG
Ga0307992_10250553F008190GAGGMEEHIEFNFIYSDDALRVKTFLGNVPRSIECINYMDIFNKLTKNDYYQFEPSDAVVSSYLMRQLQNAIGRNISTTIFYVLGNLNKETVGGIQDYVESLSDKPITYKIYHSPDIMVNGTAELFDDIIEFE
Ga0307992_10250554F018962N/AMVKIVLESARNGVIKKVIDDNYGGGNEHFTSTDVYESLEDAKSNEKTYIKRFFFDLCDDLGLEIGSKFDKAVLDINIVWGSHYEPTVKDIEVKIKRLKIELEELEEWKNI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.