NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307992_1003608

Scaffold Ga0307992_1003608


Overview

Basic Information
Taxon OID3300031601 Open in IMG/M
Scaffold IDGa0307992_1003608 Open in IMG/M
Source Dataset NameMarine microbial communities from Ellis Fjord, Antarctic Ocean - #133
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8496
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5958Long. (o)78.1913Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003058Metagenome / Metatranscriptome510Y
F003647Metagenome / Metatranscriptome475Y
F005817Metagenome / Metatranscriptome389N

Sequences

Protein IDFamilyRBSSequence
Ga0307992_100360812F003058N/AMNKLAGIIVEKIIERQKAYDEEFKADIQSMVDENTDLEFGTITQDELIIEEIDSLKERLKQLESQESYEAAAIVVNKIKHLKNKYNL
Ga0307992_10036085F005817N/AMRSNLLSRLKPEFKQGLEDNKTRYPSSIDDLEFVLSQLTFYNDLSVNQVLSLFLFSDMQYLDRKNFDWRYGEDVFELENNVA
Ga0307992_10036086F003647N/AMVMCEWTLADVKNRASNKAFAKVTILTLDIETYKRDLMEGNIGGVTYEEFEQVLEGYKTELQIWNYITELIEKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.