| Basic Information | |
|---|---|
| Taxon OID | 3300031599 Open in IMG/M |
| Scaffold ID | Ga0308007_10017323 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from water near the shore, Antarctic Ocean - #71 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2830 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Ocean | |||||||
| Coordinates | Lat. (o) | -68.5735 | Long. (o) | 77.9231 | Alt. (m) | Depth (m) | 26 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006765 | Metagenome / Metatranscriptome | 365 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0308007_100173234 | F006765 | N/A | MRRWKSGGPLLKKWRTKMKAQVKFEWRQLQEPESYQSPAYIIGNALKEAGYSIASFPQVQGTWDEDKPAHLGGPWDETRLPHEEIASE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |