NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302134_10064141

Scaffold Ga0302134_10064141


Overview

Basic Information
Taxon OID3300031596 Open in IMG/M
Scaffold IDGa0302134_10064141 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB9_SCM
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1654
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)77.9995Long. (o)-150.0065Alt. (m)Depth (m)66
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068717Metagenome124N

Sequences

Protein IDFamilyRBSSequence
Ga0302134_100641412F068717AGGAGGMHKEDTELKYEDYNRIIKAKSGHWDKTHKEALAELQPYFDKGYLETNKEGAMWLTRKGVDVLLAVGCDPIKPQEFLRDYPHMLDQMR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.