NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308135_1047140

Scaffold Ga0308135_1047140


Overview

Basic Information
Taxon OID3300031559 Open in IMG/M
Scaffold IDGa0308135_1047140 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_937_33.10 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)779
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)75.0007Long. (o)-150.0027Alt. (m)Depth (m)223
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005193Metagenome / Metatranscriptome409Y

Sequences

Protein IDFamilyRBSSequence
Ga0308135_10471402F005193AGGAMKIKNVIFENKQYFETIGKIHKSDQLSVMDAYRINRLVKKLNELNTEYDELKKKIFTQYGTPGKEEGTVEIEQENREAFAGEYNDLISIEHDLETEMLTFPSKLEDGISASDLNIMEMFFDLSGLEEKTEDEPDITTPTEKETE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.