Basic Information | |
---|---|
Taxon OID | 3300031509 Open in IMG/M |
Scaffold ID | Ga0308399_1029416 Open in IMG/M |
Source Dataset Name | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1320 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 44.5341 | Long. (o) | -110.798 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F085286 | Metagenome / Metatranscriptome | 111 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0308399_10294162 | F085286 | AGGAGG | MMARMVVPMDTLQQLLQQARVAGNAELVAQLEQAIRDAKPVKNPNAIDDWDDAREAFQAGNLTIKKEAVREAARVLFAIADQTPQYREKVLQLFSRAMRNGES |
⦗Top⦘ |